SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5GGS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5GGS9
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-85
Family Capz alpha-1 subunit 0.00000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C5GGS9
Sequence length 274
Comment (tr|C5GGS9|C5GGS9_AJEDR) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EEQ88324.2} KW=Complete proteome; Reference proteome OX=559297 OS=dermatitidis). GN=BDCG_03444 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Blastomyces.
Sequence
MPSNLEIASSFIRGAPPGELSDVVADIKALTPEGPSLISSLTPAFENYNEGQLATVKLPG
GSENVIVSAYNKLDGNRYYDVESQTSFEFDHVTQTASSPQSYVLESQHSDLIKSLLKSLS
THAREHYPSCSYGVYPTDNDSAAAILLVANKYSPNNFWNGRYRAIYTVPIPSADTITGTI
HINVHYYEDGNVSLNTTKPVSISLSPNSSADTIIKRIAAAERAQQLELSDAFSRLSEGAF
KGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences C5GGS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]