SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5H5G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5H5G9
Domain Number 1 Region: 5-301
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-78
Family Capz alpha-1 subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5H5G9
Sequence length 307
Comment (tr|C5H5G9|C5H5G9_PLABE) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:CXI83794.1} KW=Complete proteome; Reference proteome OX=5821 OS=Plasmodium berghei. GN=PBK173_000356100 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MDSLLNEKKKFIRHVLSNAPPGKVFDLISNLKTIFGSNAIIQNFIEDIISKYNEDNYILI
PFESDEYIIICKESKSGNLYLHPNLKILANVNHLKRKVIDTTPLTKLDHPDILEKYRVAC
NNKLKEYVDIYYKKWSDHQTGNYPTVNIGSKHGLNVKCASSVYASECENKYNLFLLICCD
RYYLKNFHASSWRSSWNVNFLEADQEIILTGTIDVVLTYFEDANINFKTRKVFEKRVSVT
NDIENFASSILSVIRECENDVLYDLNHLIANTSSDLIKNTRKIIPLNGDKFYWMETYQDI
PTQIKLV
Download sequence
Identical sequences A0A077XHP6 C5H5G9
PBANKA_124310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]