SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5M3K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5M3K6
Domain Number 1 Region: 24-71,117-131,179-223,279-330
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000072
Family G proteins 0.034
Further Details:      
 
Weak hits

Sequence:  C5M3K6
Domain Number - Region: 232-288
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.0602
Family DP dimerization segment 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5M3K6
Sequence length 337
Comment (tr|C5M3K6|C5M3K6_CANTT) Uncharacterized protein {ECO:0000313|EMBL:EER35906.1} KW=Complete proteome; Reference proteome OX=294747 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast). GN=CTRG_00645 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSSMLKKDSTTGVNDTNTPYNYTNPIRLAFLGGPKSGKSSTISKLTLGNFRDTYYPTHQL
NPILFNYKASTSAQRILAGSLKQNDIIVPEYLLKLNGPPSNNPYYKISNSSNKGEVSRIL
IELIDTPSFNPQSVVPFLEASLHSNLGKDILRNLANEPRKPVSTNPILVASGASEMNGNV
DGYFFVYSAIPSYSPPGYDDSSDGLSSDHSLNLIPVMKATLEEAWQEYDVFIKKKNAEKE
QDLFSMKVALKNLWREPNSSSSKSKSNKKTDSSGFYMPPVWIICTHKNSSLASPKLVADG
KRLAQEWNCGFIAIDNLDDSVDELLAYMIRDIIQTNK
Download sequence
Identical sequences C5M3K6
XP_002545864.1.44731 CTRT_00645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]