SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5M4H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5M4H5
Domain Number 1 Region: 3-254
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.62e-64
Family Capz alpha-1 subunit 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C5M4H5
Sequence length 261
Comment (tr|C5M4H5|C5M4H5_CANTT) Uncharacterized protein {ECO:0000313|EMBL:EER36225.1} KW=Complete proteome; Reference proteome OX=294747 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast). GN=CTRG_00965 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSIKLNELVDSLIETAPPAELKNVSQSLSSLTTSSIDDNIEKYAQENAVVIDNTIVSKYN
KDKNSSKYIDYINNKKFNVDWINCKIIDVENYESNFEYPKIYQELIDKLNQYGEDYYPST
FAFTIIPTEDEELRIIIIGQRANHDNFYTGQWKSNYLISKNSNISGEIKLDIHYFEDGNV
RLKFIEEISDIKIDNSSSSKIVNFINDQENKVVIKIVDQFNNLNQQSFKNLRRLLPVTRS
KINWGSAIGNYRLGSDVVNKK
Download sequence
Identical sequences C5M4H5
CTRT_00965 XP_002546183.1.44731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]