SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C5P126 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5P126
Domain Number 1 Region: 3-229
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-74
Family Capz beta-1 subunit 0.000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5P126
Sequence length 373
Comment (tr|C5P126|C5P126_COCP7) F-actin capping protein beta subunit isoforms 1 and 2, putative {ECO:0000313|EMBL:EER29384.1} KW=Complete proteome OX=222929 OS=Coccidioides posadasii (strain C735) (Valley fever fungus). GN=CPC735_070660 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MADTQFDSALDLLRRLSPRDTKRNLQYITTLVPDLTEDLLASVDQPLEIRRCRRSQRDYL
LCDYNRDGDSYRSPWSNEFDPPLEDGTVPSERVRKMEVAANEAFDVYRELYFEGGVGSVY
FWDLDDDGFAGVVLLKKGITPGSKNSGAWDSIHVFEATDRGRICHYKLTSTVILHLSTGS
EVLGDMDLSGNMTRQIEADMPIEGDASHVANVGRLVEDMELKMRNLLRTFTVKLECFEGM
IPEEARLLVLRRTDAHIFTEEVYFGKAKDVVSELRSACFLYSTLLILDSYTDMCLIRRHT
AIVRNKQGPVRSQRYDQFNDEIVIPLRTSFMRGGRLPSTWSGDIRIMIYDDSLRYLAHSC
ESKELLDNTHFDS
Download sequence
Identical sequences C5P126
222929.C5P126 XP_003071529.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]