SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C6CX04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C6CX04
Domain Number - Region: 80-123
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz beta-1 subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6CX04
Sequence length 150
Comment (tr|C6CX04|C6CX04_PAESJ) Phage protein, HK97 gp10 family {ECO:0000313|EMBL:ACT00219.1} KW=Complete proteome; Reference proteome OX=324057 OS=Paenibacillus sp. (strain JDR-2). GN=Pjdr2_1547 OC=Paenibacillus.
Sequence
MAKDKGFKIDGMDNLIKMMNKLERVPQTVVTRAARAGATIPLKAARKNAPEDTGELKRGI
VLKAERRTKIGKKVYDIMMDPAKNDLFVKYAKDGTRYYYPASQEYGFMTEDGRYIPGYRY
LRNAMTNNVKAIEAKVVEVAGKEVMKVMRG
Download sequence
Identical sequences C6CX04
gi|251795574|ref|YP_003010305.1| WP_015843164.1.29859 324057.Pjdr2_1547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]