SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C6TC60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6TC60
Domain Number 1 Region: 10-294
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.81e-80
Family Capz alpha-1 subunit 0.00000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C6TC60
Sequence length 305
Comment (tr|C6TC60|C6TC60_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:ACU19412.1} OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN= OC=Phaseoleae; Glycine; Soja.
Sequence
MAEEEEESELSDKQKVEIAKWFLLNSPPGEIQYVAKDVKSILNNDDLYKEAASEAFPYYN
KSHLISIPMPNRSGDVLVTSFGELEGNAFLEPRTAQVAIVDHAKQVCTEVRPATDEELSS
PYIEEFRCNLDAETLKYVEETYPKGFCSVYCVSGKDVEGPGADFELAVVISAARHSPQNF
CNGSWCSIWDIEFKDEQQTVEVKGKMQVGAHYFEEGNVQLDAKHECKDATLFQAPEDCAL
AITSIIRHHETEYLASLEASYLNLPDSTFKDLRRKLPVTRTLFPWHNTLQFSLTRDISKE
LGIGK
Download sequence
Identical sequences C6TC60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]