SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7GDD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C7GDD2
Domain Number - Region: 108-148
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.0288
Family DP dimerization segment 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7GDD2
Sequence length 157
Comment (tr|C7GDD2|C7GDD2_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EEV00167.1} KW=Complete proteome OX=536231 OS=Roseburia intestinalis L1-82. GN=ROSINTL182_07933 OC=Roseburia.
Sequence
MQEETTQKTIALAIKTSKLTASVLQKAMKMYLEHQKHKEPSHGKIPVKKLVGQGEGAKSI
EVTDSNIKSFERVARKYNVDFAVKKDKTMEPPKYLVFFKGKDADVIAQAFKEFVKVNEKK
QQRPSLRQKLKGLQKMIAQNKNRERSREKNKDRGQSL
Download sequence
Identical sequences A0A173T192 C7GDD2
WP_006858007.1.21182 WP_006858007.1.8661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]