SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7YLF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C7YLF3
Domain Number - Region: 36-131
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.00772
Family MukF C-terminal domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7YLF3
Sequence length 152
Comment (tr|C7YLF3|C7YLF3_NECH7) Predicted protein {ECO:0000313|EMBL:EEU47250.1} KW=Complete proteome; Reference proteome OX=660122 OS=MPVI) (Fusarium solani subsp. pisi). GN=NECHADRAFT_77511 OC=Fusarium; Fusarium solani species complex.
Sequence
MYCFPNMTQRSDPAFQRRIEDALREIDVYKINVSDLYELFRENRDDVLMHSDIYDNIRNT
VDQSLVTLERAKELVDKQRVKSASRWWRKGTISKKWKDYEQLQRVMEENNGKVQDHLRQV
QDMVKNKKPASFDLFAPRPYNTVPFTEPYDEG
Download sequence
Identical sequences C7YLF3
XP_003052963.1.20327 jgi|Necha2|77511|fgenesh1_pg.sca_2_chr3_3_0000233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]