SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C7YM44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7YM44
Domain Number 1 Region: 4-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-88
Family Capz alpha-1 subunit 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C7YM44
Sequence length 272
Comment (tr|C7YM44|C7YM44_NECH7) Predicted protein {ECO:0000313|EMBL:EEU46879.1} KW=Complete proteome; Reference proteome OX=660122 OS=MPVI) (Fusarium solani subsp. pisi). GN=NECHADRAFT_99630 OC=Fusarium; Fusarium solani species complex.
Sequence
MSEIETVSSFVEGAPPGELADVVADIKALAISSPDIISDLAPAFEKYNEEQFVTVKLPGS
SQPVIISSHNSLGDGRYYDVESSSSFAFNHATQKASAVQSHVLEGPQTDLVKSTLKSLSA
YVSEHFPNAAYGVYPIQSDSQIAVIIVGNKYSPNNFWNGRWRSLYIFDPSSGTLEGSIKV
DVHYYEDGNVRLLTNKPVSGSIPSGSGAGVIKEISSTERKYQEELNKGFVSLSEGAFKGL
RRQLPVTRQKIEWDRVTSYRLGQDIGGGSSRR
Download sequence
Identical sequences C7YM44
jgi|Necha2|99630|estExt_fgenesh1_pg.C_sca_2_chr3_3_00472 XP_003052592.1.20327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]