SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8PK86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C8PK86
Domain Number - Region: 5-54
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0235
Family Preprotein translocase SecE subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C8PK86
Sequence length 57
Comment (tr|C8PK86|C8PK86_9PROT) Protein translocase subunit SecE {ECO:0000256|HAMAP-Rule:MF_00422} KW=Complete proteome; Reference proteome OX=553220 OS=Campylobacter gracilis RM3268. GN=CAMGR0001_1791 OC=Campylobacteraceae; Campylobacter.
Sequence
MEKVKEYYKQAKVELDKVIFPTKDQTKTAYISVVVVVVVIALFLALVDLIMSALITA
Download sequence
Identical sequences C8PK86
WP_005872632.1.32819 WP_005872632.1.45330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]