SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9RHU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C9RHU8
Domain Number - Region: 3-61
Classification Level Classification E-value
Superfamily AF1862-like 0.000641
Family Cas Cmr5-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9RHU8
Sequence length 122
Comment (tr|C9RHU8|C9RHU8_METVM) Uncharacterized protein {ECO:0000313|EMBL:ACX73150.1} KW=Complete proteome OX=579137 OS=(Methanococcus vulcanius). GN=Metvu_1297 OC=Methanocaldococcaceae; Methanocaldococcus.
Sequence
MGNLEMMINNVAFKIVKEIENMKKEEKEWKKYKNEIEKALGVLSNDGVYAYWVYCKSKEI
DKIFIEKIEPLMKYTKTTLNDGSYEEYFQKLSNDINDLLFFKEILERTLILARYHAKALG
DD
Download sequence
Identical sequences C9RHU8
579137.Metvu_1297 WP_015733370.1.10243 gi|261403408|ref|YP_003247632.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]