SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9ST53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9ST53
Domain Number 1 Region: 4-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-86
Family Capz alpha-1 subunit 0.00000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9ST53
Sequence length 273
Comment (tr|C9ST53|C9ST53_VERA1) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EEY21968.1} KW=Complete proteome; Reference proteome OX=526221 OS=(Verticillium wilt of alfalfa) (Verticillium albo-atrum). GN=VDBG_08078 OC=Plectosphaerellaceae; Verticillium.
Sequence
MSEVETVSAFVEGAPPGELADVIADIKSLTIDNPDIVSNLAPAFEKYNEEQLITVKLPGS
SQSVIISAHNSLGQGQYFDVESSSSFTFDHPTQKASNVQSYVLEGAQADLVKSTLKSLGP
YVKEHFANAAYGVYPIEEDSKVAVVIVSNKYSPNNFWNGRWRSIYTFDPASGALEGSIKV
DVHYYEDGNVRLLTDRPSTASVSSGTGAGIVKEISAAEKKYQDELNRGFTNLSEGTFKGL
RRQLPVTRQKIEWDKVTSYRLGQDIGGGSGSRR
Download sequence
Identical sequences C9ST53
XP_003001819.1.67963 VDBG_08078T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]