SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0NIM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0NIM1
Domain Number 1 Region: 11-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-73
Family Capz beta-1 subunit 0.000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0NIM1
Sequence length 288
Comment (tr|D0NIM1|D0NIM1_PHYIT) F-actin-capping protein subunit beta, putative {ECO:0000313|EMBL:EEY59355.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_11366 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSTDASAADGGMTSCLNLMRRMPPREVETDVYNLTRLVPSIADELYQRVDQPLQVAVDPA
NGRKYLLCDYNRDGDSYRSPWTNQYDPPASDGEGFFPSETLRELEVHANEIFDSYRELYY
QGGISSVYMWDLELGFAACFLVKKDVLDQRFIEKGEWNSIHVIEVQEGSDVLDKGVKKAT
YRLTTSVLLSMKVNRPELGDLTLDGTLTRQAERTMEFEDQFAHVSNMGRMVEDMEIDMRS
SLDGLYISKTREVINGMRKLQQGPAMANPFVGELNSAVLKHGQKKQQE
Download sequence
Identical sequences D0NIM1
XP_002900965.1.21288 PITG_11366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]