SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0NYA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0NYA7
Domain Number 1 Region: 10-74
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000000000889
Family Capz alpha-1 subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0NYA7
Sequence length 77
Comment (tr|D0NYA7|D0NYA7_PHYIT) Uncharacterized protein {ECO:0000313|EMBL:EEY68096.1} KW=Complete proteome; Reference proteome OX=403677 OS=Phytophthora infestans (strain T30-4) (Potato late blight fungus). GN=PITG_18541 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAEEWAYEEASDEEKLQIAQRFLLASPPGQVHEVLRDVAKLVPAHVLPDAALRGALHAYN
VKNCVPVDVPDADYKVY
Download sequence
Identical sequences D0NYA7
PITG_18541 XP_002997654.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]