SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0WW90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D0WW90
Domain Number - Region: 137-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz alpha-1 subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0WW90
Sequence length 332
Comment (tr|D0WW90|D0WW90_VIBAL) Putative lipopolysaccharide A protein {ECO:0000313|EMBL:EEZ83711.1} KW=Complete proteome OX=674977 OS=Vibrio alginolyticus 40B. GN=VMC_14400 OC=Vibrionaceae; Vibrio.
Sequence
MAEVSNNSFPSQSPSRLGKNSMKDSKFPYYFSNALSILIPRFVYRAQAKRLLSNLTEAEQ
QRCIERVNYYNKCETPFSVDSREQSYSTIDTFKKTKGWTYFFDLRQVVRYFPSSFAFNYI
NGDVTHIPHVPSFIKSRPIFGNNQNSVVLKLNQVRHFKFIDDPVRYQDKKDMVAWRGVGF
QPHRKKVIHAFYNHPQCNIGQTRPVEGKPWEKGFMSIEEQLQYKFLLCIEGNDVATNLKW
AMSSNSLVIMSKPKYETWFMEGKLEAGVHYVEVKDDYSDLPEKMDYYLANEQEALAIIEN
AHQWVEQFKDKRKERLISLMVADKYFALSQQQ
Download sequence
Identical sequences D0WW90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]