SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0X4W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D0X4W5
Domain Number - Region: 116-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz alpha-1 subunit 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0X4W5
Sequence length 311
Comment (tr|D0X4W5|D0X4W5_VIBH1) Uncharacterized protein {ECO:0000313|EMBL:EEZ89874.1} KW=Complete proteome OX=673519 OS=Vibrio harveyi (strain 1DA3). GN=VME_01280 OC=Vibrionaceae; Vibrio.
Sequence
MKDSKFPYYFSNALSMLLPCFVYRAQAKRLLSTLNEAEKQYCLDRVNYYNKCEQSFSVDS
REQSCAKIGEFKKTKGWTYFFDTRQVIRYFPSEFTFNYINGDVTHIPNVPSFIKSRPIHG
DNQNSIVLKLNQIRHFKFVDDKMSYRDKKDMVAWRGVGFQPHRQTVIHAFYDHPQCNIGQ
TRPQEGQPWEKGFMSIEEQLQYKFLLCIEGNDVATNLKWAMSSNSLVIMSKPKYETWFME
GKLEAGIHYVEVKDDYSDLPEKMDYYLANEQEALAIIENAHQWVEQFKDKRKERLISLMV
ADKYFTLSQQQ
Download sequence
Identical sequences D0X4W5
WP_005434394.1.86250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]