SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2CUJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2CUJ1
Domain Number 1 Region: 199-267
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.000000000441
Family Biotin dependent carboxylase carboxyltransferase domain 0.0026
Further Details:      
 
Weak hits

Sequence:  D2CUJ1
Domain Number - Region: 92-159
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz beta-1 subunit 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2CUJ1
Sequence length 269
Comment (tr|D2CUJ1|D2CUJ1_9CARY) Acetyl-coA carboxylase beta subunit {ECO:0000313|EMBL:ACK76101.1} OX=137669 OS=Atraphaxis spinosa. GN=accD OC=Atraphaxis.
Sequence
MKKWWFNSVLSKEEFEHRWGLSKSMSSLDPIDNTSSSENMSRNSTEKNIHSRSNGSSYIN
FDLLFGIRDIRNFISDETFLVRDSKGETFSIFFDIENQIVEIENDHSFSSELQKEFSNSW
NSSYGNGSKNDDTHYNLCMYDTKSSLNNYINSCIDSYLHSQMCIDNSVLSDSDNFIFDES
QTTTKTNGRDKNLAVTKKYRNLWIQCENCYELNYKKLLKSKMNICDECGYHLKMSSSERI
ELLIHPGTWDPMDEDMVSTDPIGFHSEEE
Download sequence
Identical sequences D2CUJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]