SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2H273 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2H273
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.98e-98
Family Capz beta-1 subunit 0.000000000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2H273
Sequence length 277
Comment (tr|D2H273|D2H273_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB18611.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_003704 OC=Ailuropoda.
Sequence
QSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVDVIPDHPKFQQLQRELSQVLTQRQIHIQPDN
Download sequence
Identical sequences D2H273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]