SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2QIU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2QIU1
Domain Number - Region: 63-121
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0497
Family Capz alpha-1 subunit 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2QIU1
Sequence length 142
Comment (tr|D2QIU1|D2QIU1_SPILD) Uncharacterized protein {ECO:0000313|EMBL:ADB40017.1} KW=Complete proteome; Reference proteome OX=504472 OS=Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896). GN=Slin_4027 OC=Spirosoma.
Sequence
MNLTNSQNTMAFKTLLSVVLLLTLTVQAVKAQNSPATSDSLTTLTGKWAGTFDGPASGKL
ELVLNQDNNRNVTGKITAINNSGDQYSADLKTVIWQNGKLTITYTYPEGGDVNLSGNYAK
SAFKGTWELGGGQATGTWQASR
Download sequence
Identical sequences D2QIU1
gi|284038886|ref|YP_003388816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]