SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2S8Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2S8Z5
Domain Number - Region: 45-96
Classification Level Classification E-value
Superfamily TSP9-like 0.0471
Family TSP9-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2S8Z5
Sequence length 113
Comment (tr|D2S8Z5|D2S8Z5_GEOOG) Regulatory protein, FmdB family {ECO:0000313|EMBL:ADB73638.1} KW=Complete proteome; Reference proteome OX=526225 OS=G-20). GN=Gobs_0875 OC=Geodermatophilus.
Sequence
MPTYQYACTNPDGKHQFEVVQSFTDAPVSECPECGSPVRKVYGSVGVVFKGSGFYRTDSR
SKASSSESGSSSNGTKDAAPAAAGNSSSSSSTSSSGSSSSSGSSTSSSSAAAG
Download sequence
Identical sequences D2S8Z5
gi|284989455|ref|YP_003408009.1| WP_012947079.1.76031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]