SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2T6X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2T6X6
Domain Number - Region: 44-92
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0484
Family Moesin tail domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2T6X6
Sequence length 214
Comment (tr|D2T6X6|D2T6X6_ERWP6) Uncharacterized protein {ECO:0000313|EMBL:CAY75633.1} KW=Complete proteome OX=644651 OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96). GN=EPYR_03253 OC=Erwiniaceae; Erwinia.
Sequence
MVVSLIFGDTTMHLLNITHFVAAFAERAACLFAPERRFSAWLYRFKYGAEALRMASQLER
LRAELERAKAEFKRINAGCQFEDSWHNENFAKFIRTFSVSIIPAQSAIGFIAVISEAEGL
LLSIRALNRLAVNAEAGPEGYSQGAWQVFRIAEVIGFSCEAKFISQDLFEKYVTDLILLG
NEIDARAWNHGFNEGIKRVLDVEYRIVKMPQSFS
Download sequence
Identical sequences D0UIY5 D2T6X6
gi|387872620|ref|YP_005804004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]