SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2ZQV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2ZQV6
Domain Number - Region: 88-135
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 0.0942
Family Aromatic compound dioxygenase 0.017
Further Details:      
 
Domain Number - Region: 31-112
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0994
Family Capz alpha-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2ZQV6
Sequence length 148
Comment (tr|D2ZQV6|D2ZQV6_METSM) Uncharacterized protein {ECO:0000313|EMBL:EFC93653.1} KW=Complete proteome OX=521002 OS=Methanobrevibacter smithii DSM 2374. GN=METSMIF1_03238 OC=Methanobacteriaceae; Methanobrevibacter.
Sequence
MVEVNLYNYNGFDFNSNKIEFNGTKFNLPENFNVANESENTISLYDKSDNITINMTHLND
NISIKTYFQKALKDNFTVSNETQKIDNITLYVTYRETNYTNSTQLFFEKDNTNYRMWILN
YDNKNEYSSKIAAEIITSLRPANQGYIG
Download sequence
Identical sequences D2ZQV6
2004046436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]