SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3BLH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3BLH6
Domain Number 1 Region: 3-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.11e-90
Family Capz beta-1 subunit 0.000000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3BLH6
Sequence length 269
Comment (tr|D3BLH6|D3BLH6_POLPP) Subunit of heterodimeric actin capping protein cap32/34 {ECO:0000313|EMBL:EFA77741.1} KW=Complete proteome; Reference proteome OX=670386 OS=(Heterostelium pallidum). GN=PPL_12353 OC=Acytosteliaceae; Heterostelium.
Sequence
MSKLDSALDLMRRLPPAQIEDNLAGLLDLVPDLTEDLLSSVDQPLKIAFDPVSKRDYLLC
DYNRDGDSYRSPWSNKYDPPIGDGALPSPKLREIEVQANEVFDIYRELYFEGGVSSVYCW
DLDGGFAAVVLIKKTQDQSKKGQPMRGTWDSIHVVEVKDMKKNARYKLTSTIMLSIETEN
DNTGNVNLSGSLTRQEEKEAPVNDVDTHITNIGKMVEEMESKLRLTLETIYFGKTKQVVN
ELRSATGSSELEKRKNLSNQIGSALSSRQ
Download sequence
Identical sequences D3BLH6
XP_020429869.1.83155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]