SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3FU56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3FU56
Domain Number 1 Region: 6-84
Classification Level Classification E-value
Superfamily EF2458-like 9.81e-37
Family EF2458-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3FU56
Sequence length 93
Comment (tr|D3FU56|D3FU56_BACPE) UPF0358 protein BpOF4_00950 {ECO:0000256|HAMAP-Rule:MF_01560} KW=Complete proteome; Reference proteome OX=398511 OS=Bacillus pseudofirmus (strain OF4). GN=BpOF4_00950 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSQEMVNKHNERAYALLKSDAEKIQQLIEVQMENLTMPQCPLYEEVLDTQMFGLSREIDF
AIRLELVREEEGKQLLNELERKLAALHEASLRK
Download sequence
Identical sequences A0A1Q9PSY4 D3FU56 U6SNX4
WP_012959540.1.66041 WP_012959540.1.79403 WP_012959540.1.97837 gi|288553215|ref|YP_003425150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]