SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3PCL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3PCL9
Domain Number 1 Region: 387-538
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.73e-45
Family GGDEF domain 0.000075
Further Details:      
 
Domain Number 2 Region: 76-198
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000000392
Family Sensory domain of two-component sensor kinase 0.038
Further Details:      
 
Weak hits

Sequence:  D3PCL9
Domain Number - Region: 184-249
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000366
Family Capz alpha-1 subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3PCL9
Sequence length 538
Comment (tr|D3PCL9|D3PCL9_DEFDS) Uncharacterized protein {ECO:0000313|EMBL:BAI80342.1} KW=Complete proteome; Reference proteome OX=639282 OS=101012 / SSM1). GN=DEFDS_0866 OC=Deferribacter.
Sequence
MRVLNKPKKFKSLRVILFKNITLIFISLFLLLSIYISKTLYDNGIESIYTTLEERNKADK
YYIESYFTKIHNAVKILSKIDVIKNAIYLSDNQKQFALKLFKYTEDSDPDINYVYAGYID
GSLLINNYTPPKGYNPMIRPWYIAAIKSFPNVSNGIPYQEIKTKEWLISISKTLVDNNGK
IVGVIAIDSDFSKITSKINKYIKNYKSTNSFIIKEDTGEIIITPNNHFLRKKYYNYINNI
NFVYDHKKISFTLNGDPKLGYYSKIPILGWIIVTSVSKKEVITPIYNRLIILNITFLIMI
ILFGWFLSKSFMKKIINPLIILNDKLLQITQNKKIDIKLNTFEYPNNEIGIIAKELEKLT
TTELYKKNKELEKINQKLQKLSITDCLTKLYNRGKIEKDLTNEYNKAIRYNDTFSIILFD
IDNFKIINDTYGHQMGDKILIEIANLTKETIRNTDIAARWGGEEFLILCPKTNINSAFNL
AERLRKKIESHDFSIDKRITISGGIAEFKKGLTIDEMLKQADDNLYKAKKEGKNRVIF
Download sequence
Identical sequences D3PCL9
WP_013007590.1.2578 gi|291279263|ref|YP_003496098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]