SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3RYE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3RYE1
Domain Number 1 Region: 4-53
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.000000000000222
Family Preprotein translocase SecE subunit 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3RYE1
Sequence length 57
Comment (tr|D3RYE1|D3RYE1_FERPA) Protein transport protein Sec61 gamma subunit homolog {ECO:0000256|HAMAP-Rule:MF_00422} KW=Complete proteome; Reference proteome OX=589924 OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO). GN=Ferp_1353 OC=Archaeoglobaceae; Ferroglobus.
Sequence
MLSNTIKEYVNILKMTRKPDKEEFWTTTKVAVAVMFIVGFIGFVIYLLMDVLPGALK
Download sequence
Identical sequences D3RYE1
WP_012965847.1.13673 gi|288931719|ref|YP_003435779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]