SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3SGM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3SGM3
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000235
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Weak hits

Sequence:  D3SGM3
Domain Number - Region: 76-122
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00667
Family Rubredoxin 0.032
Further Details:      
 
Domain Number - Region: 122-141
Classification Level Classification E-value
Superfamily MtlR-like 0.0759
Family MtlR-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3SGM3
Sequence length 188
Comment (tr|D3SGM3|D3SGM3_THISK) Cold-shock DNA-binding domain protein {ECO:0000313|EMBL:ADC73264.1} KW=Complete proteome; Reference proteome OX=396595 OS=Thioalkalivibrio sp. (strain K90mix). GN=TK90_2779 OC=Ectothiorhodospiraceae; Thioalkalivibrio.
Sequence
MKGTIKWYSDEKGYGYVVDPAGKERFFGAKHVQGTSTPSSGDSVSFKPGLDRKGAPIARS
IQIHARGPANEDPREICRHCNRKMTPRVVVGKPIITMGTWTPEPKYSLCPYCAGRHKDFQ
PADGPLKALTVTISVIFALGVGGFVLHTHLTWDDRSQPVERTSPPQMDERRQQFEERHQR
FMEQFREE
Download sequence
Identical sequences D3SGM3
gi|290243061|ref|YP_003494731.1|NC_013930 gi|290243061|ref|YP_003494731.1| WP_013006629.1.15078 WP_013006629.1.27442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]