SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3SPS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3SPS2
Domain Number 1 Region: 2-285
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.69e-104
Family Methylenetetrahydrofolate reductase 0.000000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3SPS2
Sequence length 292
Comment (tr|D3SPS2|D3SPS2_THEAH) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=638303 OS=Thermocrinis albus (strain DSM 14484 / JCM 11386 / HI 11/12). GN=Thal_0525 OC=Bacteria; Aquificae; Aquificales; Aquificaceae; Thermocrinis.
Sequence
MKIRDLLRKGFSISFEFFPPKTEEGEEELFETIRNLQSINPTFVSVTYGAGGSTREKTRR
VVERIHRETSLTVMAHLTCIAHTEEELTEILRGYREIGIENILALRGDRPKDNSATEKRG
CQYAYQLVRLIRTKFGDHFSVGVASYPEGHPESPNLEWEVRYFKMKVEEGADFSITQMFF
DNSYYYRFVELCRKEGIDIPIIPGIMPITNFRQIQRFASMCGASIPHHVVQRLEPYAHLP
QETMKVGVELAIKQCEDLIENGVPGLHFYTLNKSKATLLIYDAIKDRVPTKI
Download sequence
Identical sequences D3SPS2
WP_012991566.1.53471 gi|289548298|ref|YP_003473286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]