SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3ZM82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZM82
Domain Number 1 Region: 19-142
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000117
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  D3ZM82
Domain Number - Region: 380-418
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0325
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3ZM82
Sequence length 469
Comment (tr|D3ZM82|D3ZM82_RAT) Similar to RIKEN cDNA 9930023K05 (Predicted) {ECO:0000313|EMBL:EDL94497.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_57645 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MEARPPKGPGKQFTFDYENEVHKRDYFIKSPPPQLFFSATSWKKRLFILSQSQGKGLSLS
YYKDHHRRGSIEIDGSATVEVGINSQEKMQSVQKMFKCHPDEVMCIRTVTRDYFLIGRDR
EKIKDWVSFMTPYCRGVKATHQRAEEKPSLGDRRPVSDPSPFLGLCNIPEGISLASPRAS
LPEHLIQKSLQRFRQDHYHHEHDFYSEPTQDAEEEEYYLTPRSLENIDGANDSGDSAESN
SPDQGFKRAESNYVSMRSMRSCLVKEATSAPADCQAEFQISPETSELGPPHQEQDTGSDP
CLLPADSEAQTTDDQQGSASLTVVKLSILLNNITDESQVETLNVFLSPRDVINYLALVEA
AGRICVARWEGPPRLGCLFHHGDHILAVNDLKPQSLEEVSLFLTRCIQKEKVKLSIGRIP
NSEKLHAFPCACSLRHQFAESAQQDLPGRERTPKRSPAIKKNQKEAIGE
Download sequence
Identical sequences D3ZM82
10116.ENSRNOP00000022724 ENSRNOP00000022724 ENSRNOP00000022724 NP_001128085.1.100692 NP_001128085.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]