SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3ZVN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZVN8
Domain Number 1 Region: 8-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.06e-101
Family Capz alpha-1 subunit 0.0000000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3ZVN8
Sequence length 288
Comment (tr|D3ZVN8|D3ZVN8_RAT) Similar to RIKEN cDNA 4933400A11 {ECO:0000313|Ensembl:ENSRNOP00000004893} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=RGD1563947 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MANHKVRASDEKKVYLASKFITQAPPGEFKEVFCDIRLLVNNDDLLRKRMGQAIAQYNMD
QFIPVKLEGYDDHVLVTEHGYLGNNRFLDPRNRISFKFDHLRKIACDPQLRLTEQNLTYL
RDSCDRALRAYMKQNYSTGFSTVYGKIINGKKTIIACIESHQFQPQKFWNGCWRSQWKLT
VTPPTAQVIGMLKSQVHYYENGNIQLVVHKDIQESLTVFSEDQTAKVFIKIIEKVENGYQ
AAVNENYRTISHTAFKALRRQLPITYHKVDWNKILNYKVSKELKTRSA
Download sequence
Identical sequences D3ZVN8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]