SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4A9W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4A9W0
Domain Number 1 Region: 155-255
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 1.26e-39
Family HIN-200/IF120x domain 0.00016
Further Details:      
 
Domain Number 2 Region: 256-343
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 1.73e-27
Family HIN-200/IF120x domain 0.0013
Further Details:      
 
Domain Number 3 Region: 4-85
Classification Level Classification E-value
Superfamily DEATH domain 5.77e-17
Family Pyrin domain, PYD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D4A9W0
Sequence length 356
Comment (tr|D4A9W0|D4A9W0_RAT) Absent in melanoma 2 {ECO:0000313|Ensembl:ENSRNOP00000033110} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Aim2 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MESDFREMLLLTGLDHITEEELKRFKYLALTEFNIPRKTLNIADRTELADQLIQSAGAAS
AVAKAISIFQKLNYMDIAKALEEKKKEAESKYVTNTKKRGTQKVENRSQAKNCSVASATC
SDKDFKGHSATEVCPQVKPQKKQMVAEQEAIREDLQQDSLVVMVLKAMNPFECETQEGKQ
KIFHATVATETEFFFVKVLNAQFKDKFIPKRTIQISNYLRHSYFVEVTSSSVVVDVESSH
KVCVPNNIMKKAGETPKISKLKTLPCGTIVNGLFKVQKITEQKDRVIYGIHDKRGTMEVL
VLGNQSKTKCEEGDKIRLTFFEVSNNRGKIQLKSGPCSIYKVIKAAKPKTKVKSVE
Download sequence
Identical sequences D4A9W0
XP_001057147.2.4139 XP_006221618.1.4139 XP_006221619.1.4139 XP_006250397.1.100692 XP_006250398.1.100692 XP_008761781.1.4139 XP_008761783.1.4139 XP_008761788.1.4139 XP_008768024.1.100692 XP_008768025.1.100692 XP_008768027.1.100692 XP_017454492.1.100692 XP_017460141.1.4139 XP_222949.5.100692 ENSRNOP00000033110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]