SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4AM11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4AM11
Domain Number 1 Region: 43-201
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-48
Family Capz alpha-1 subunit 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D4AM11
Sequence length 209
Comment (tr|D4AM11|D4AM11_ARTBC) Uncharacterized protein {ECO:0000313|EMBL:EFE36420.1} KW=Complete proteome; Reference proteome OX=663331 OS=(Trichophyton mentagrophytes). GN=ARB_05359 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MIGRYRQPPTPDHMCLNLRTQTSCQFTASASSAPCKQPMPILTDPFRKSYLKLLSSHASE
HYPNSSYGVYPSQDDSSIAILLVANKYSPNNFWNGRYRAIYNVPVSSGGTITGTIHVDVH
YYEDGNVSLNNKKPVSISITSASPADAAFKRIVTTEREHQEELNDAFNRLSEGAFKGLRR
QLPITRQKVEWEKIGAYRLGKDISGGTGY
Download sequence
Identical sequences D4AM11
XP_003017065.1.35196 ARB_05359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]