SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4DB84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4DB84
Domain Number 1 Region: 44-207
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-48
Family Capz alpha-1 subunit 0.0000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D4DB84
Sequence length 215
Comment (tr|D4DB84|D4DB84_TRIVH) Uncharacterized protein {ECO:0000313|EMBL:EFE40918.1} KW=Complete proteome OX=663202 OS=Trichophyton verrucosum (strain HKI 0517). GN=TRV_04383 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MTFMLLIISQYRQPPTPGHMCLNLRTQTSCQLTTSASFAPYKQPMPILTDPFRKSYLKLL
SSHASEHYPNSSYGVYPSQDDSSIAILLVANKYSPNNFWNGRYRAIYNVPVSSGGTITGT
IHVDVHYYEDGNVSLNNKKPVSISITSASPADTAFKRIVTTEREHQEELNDAFNRLSEGA
FKGLRRQLPITRQKVEWEKIGAYRLGKDISGGTGY
Download sequence
Identical sequences D4DB84
TRV_04383 XP_003021536.1.33076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]