SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4RLG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D4RLG4
Domain Number - Region: 28-96
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz alpha-1 subunit 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D4RLG4
Sequence length 138
Comment (tr|D4RLG4|D4RLG4_ENTFC) Uncharacterized protein {ECO:0000313|EMBL:EFF25221.1} KW=Complete proteome OX=546340 OS=Enterococcus faecium E1679. GN=EfmE1679_2783 OC=Enterococcus.
Sequence
MYMKYAEVPSFLSPSPAKHVSNGNAWAKNVVSGNDILGSFYSEYKAWVRGTSKTKTIKGT
FAFTSGDKYYALHNVKYSYSFVRQSNGSVKTTGVVTDVYDFAPSNYESIKVGFANNYAYA
MQSLGLIKPFNIEIKHSF
Download sequence
Identical sequences A0A1A7UP67 D4RLG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]