SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EWM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EWM6
Domain Number 1 Region: 271-568
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 8.11e-82
Family DNA repair protein MutS, domain III 0.00000207
Further Details:      
 
Domain Number 2 Region: 570-806
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-56
Family ABC transporter ATPase domain-like 0.00000136
Further Details:      
 
Domain Number 3 Region: 5-117
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 9.55e-39
Family DNA repair protein MutS, domain I 0.0000568
Further Details:      
 
Domain Number 4 Region: 117-270
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.44e-38
Family DNA repair protein MutS, domain II 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EWM6
Sequence length 874
Comment (tr|D5EWM6|D5EWM6_PRER2) DNA mismatch repair protein MutS {ECO:0000256|HAMAP-Rule:MF_00096, ECO:0000256|SAAS:SAAS00825254} KW=Complete proteome; Reference proteome OX=264731 OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23). GN=PRU_2504 OC=Prevotella.
Sequence
MAKTAGKELTPMMKQFFDLKAKHPDAVMLFRCGDFYETYCEDAITASKILGITLTHRSNG
AGGKGDEMAGFPHHALDTYLPKLIRAGKRVAICDQLEDPKLTKKLVKRGITELVTPGVAM
SDNVLNYKENNFLAAIHFGKSSFGVAFLDISTGEFLTGEGTADYVEKLLGNFSPKEVLYD
RNRKQDFERNFGTKYFTFQLDDWVFTDQTGKQKLLQHFNVKNLKGFGVDHLQSGVIAAGA
ILQYLEQTQHTQIGHITSISRIEEDKYVRLDKFTIRSLELVYPMQEDGKSLLDVIDKTVS
PMGGRLLRRWLVFPLKDEKPINERLDVVEYYYREPEFRECIDDQIHRIGDLERIISKAAV
GRVSPREVVQLKTALQAIQPIKTACLYAKNPTLNRIGEQLNLCESLRDRIEKEIQNDPPQ
LVAKGGVIRDGVNAELDELRSIAYSGKDYLLKIQEREAQETGIQSLKIGYNNVFGYYLEV
RNTYKEQVPPEWVRKQTLAQAERYITQELKEYEEKILGAEDKILSLEGKLFNDLIMSMQE
FIPQIQINANIIARLDCLLSFAKAAEENKYIRPVIDSSEVIDIRQGRHPVIEQELPLGEY
YVPNDILLDNERQQIIIITGPNMAGKSALLRQTALIVLLAQIGCFVPAEAARIGLVDKIF
TRVGASDNISLGESTFMVEMTEASNILNNVSSRSLVLFDELGRGTSTYDGISIAWAIVEY
LHENAKGHPRTLFATHYHELNEMEKNFSRIKNYNVSVKEVDGKVIFLRKLERGGSEHSFG
IHVAEIAGMPRSIVKRANVILKQLESDNAQVGTAGKPTKEIAGSREGMQLSFFQLDDPVL
CQVRDEILGLDVNNLTPIEALNKLNDIKKIVSGK
Download sequence
Identical sequences A0A1H6LNQ4 D5EWM6
WP_013063694.1.33358 WP_013063694.1.49956 gi|294675138|ref|YP_003575754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]