SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5G7B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5G7B6
Domain Number 1 Region: 4-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-87
Family Capz beta-1 subunit 0.0000000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5G7B6
Sequence length 273
Comment (tr|D5G7B6|D5G7B6_TUBMM) Uncharacterized protein {ECO:0000313|EMBL:CAZ80409.1} KW=Complete proteome; Reference proteome OX=656061 OS=Tuber melanosporum (strain Mel28) (Perigord black truffle). GN=GSTUM_00002429001 OC=Pezizales; Tuberaceae; Tuber.
Sequence
MASQDPFDSALDLLRRLNPKYTANNVNALINLVPDLTEDLLSSVDQPLQVQRCKKTGRDY
LLCDYNRDGDSYRSPWSNEFDPPLTDGTLPSERVRGIEIAANDAFDIYRELYYEGGVSSV
YFWNLDDGFAGVVLLKKCMYQSFVSSANESTGSWDSIHVFEATDRARISHYKLTSTVILN
MINGDESLGEMDLSGNMTRQVEQDMPVGDDSSHIANIGKLVEDMELKMRNLLQEVYFGKA
KDVVGDLRSISSLTQQEKDRSMHQEMISSMSKR
Download sequence
Identical sequences D5G7B6
CAZ80409 XP_002836218.1.11696 GSTUMT00002429001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]