SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6GTI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D6GTI5
Domain Number - Region: 184-244
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0016
Family Capz alpha-1 subunit 0.013
Further Details:      
 
Domain Number - Region: 136-179
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0493
Family PepSY-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6GTI5
Sequence length 272
Comment (tr|D6GTI5|D6GTI5_FILAD) Peptidase propeptide and YPEB domain protein {ECO:0000313|EMBL:EFE27792.2} KW=Complete proteome; Reference proteome OX=546269 OS=Filifactor alocis (strain ATCC 35896 / D40 B5) (Fusobacterium alocis). GN=HMPREF0389_01423 OC=Peptostreptococcaceae; Filifactor.
Sequence
MKTNKKTKVISALLISGAIGLTLLSAPFSAFADTVKSTIGTQKAKTIALNDAKVKSSNAR
FVTAKLDREDGRIVYDIEFYVGNREYDYEIDAYTGRILSKDADIEYVAPKAVTKKQQGNI
GIAKAKNIALNDAKVKASNARFVTAKFDIEDGKQVYEVEFYVGNKEYDYVIDAGTGRILE
KDTDLENDVIVTAPSKTQGGKYIGAEKAKSIALNHSKKKASDVSFVKTELDQDDGRVVYD
IQFYFGNKKYNYEIDATTGKILSYEEDNVDFD
Download sequence
Identical sequences D6GTI5
gi|374308174|ref|YP_005054605.1| WP_014262517.1.100256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]