SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6KPN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D6KPN4
Domain Number - Region: 38-152
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00314
Family Capz beta-1 subunit 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6KPN4
Sequence length 444
Comment (tr|D6KPN4|D6KPN4_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EFG24732.2} KW=Complete proteome OX=450749 OS=Veillonella sp. 6_1_27. GN=HMPREF0874_00921 OC=Veillonella.
Sequence
MTKLPLLACTFIMSTILSPIGAIDVNIPGADSKIPKDAYVNYQTTNPDIEKDVANYVKTL
KLTDKANGINKNEIKYTKAASIYRGQHYHNTVISVHDQYNQIRLSFPVAGIKSDYHIGRY
QNPSRTIEDYRVLTNNGSLNLEIDYADFKDYDWRNTKTAYEKLTDKDVRNFLQDNAKRKS
SKQISDIKGTVFSYPTVTYSTWDSMKMPHFENGKKATLTIDTINFKFKGYNMRHPLYHAG
FVYYDNNPVLNKVPTDKLLANYVLPSVQNLNELNQYSRIESLNGVQYRVPKDAIYEGESK
GSEHQDIRYYKKGDITFFVSTDNVPRNPYAHELVINGHYNFKTDLNTFWDIYRYHPSASD
YINYSVVWNNNIPGLSIHSYEPNKDDHILTFNSYDGTYSFTYIIFYPSFLHAKEVQKLRN
MIEFFDSTNNPSFKMQEHVLFPEA
Download sequence
Identical sequences A0A117J2A8 D6KPN4 W1UY10
WP_008601994.1.89407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]