SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6PFG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D6PFG0
Domain Number - Region: 80-107
Classification Level Classification E-value
Superfamily STI-like 0.0285
Family Kunitz (STI) inhibitors 0.042
Further Details:      
 
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz beta-1 subunit 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6PFG0
Sequence length 116
Comment (tr|D6PFG0|D6PFG0_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:ADD94461.1} OX=743564 OS=uncultured phage MedDCM-OCT-S05-C767. GN= OC=Viruses; environmental samples; uncultured environmental isolates.
Sequence
MSQYRLETEEDMSAYLDINFGHGVTATYTVGGSSSTINIIINNEYVEQVEGTGVEALKPI
AYCRSIDVPSVAFGNTLNVSAIKDVDGNTLKAAQNYTIVNVQSDRTGFSALMLEEI
Download sequence
Identical sequences D6PFG0
D6PFG0_9VIRU

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]