SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6Q009 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6Q009
Domain Number 1 Region: 53-72,111-142,276-362
Classification Level Classification E-value
Superfamily OMPA-like 0.000000000549
Family Outer membrane protein 0.034
Further Details:      
 
Weak hits

Sequence:  D6Q009
Domain Number - Region: 169-225
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0107
Family Capz alpha-1 subunit 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6Q009
Sequence length 376
Comment (tr|D6Q009|D6Q009_ANAMA) Outer membrane protein 4 {ECO:0000313|EMBL:ADF87318.1} OX=770 OS=Anaplasma marginale. GN= OC=Anaplasmataceae; Anaplasma.
Sequence
QHIIEYRRKSLMGVVFVNYARSFLAGTMALSAVCLNFALPSVAQADASDWEQQDGFYAGF
TLNPSYSRVQNFKLKDAGNDPAGILAYHSGIGTVPERFDWDTLDANVEFGNSSFPALEGI
IGFSMQGFRVELGIGREAFPVKTDEAGSSRTFLLIRNLARAVAQHDSDTIESELFQHTGG
DTQKIKSMVSGIEEMEEALRGSVEQRFVDIMQSIQKDPKAAFPRSAVKHLVAGYGAEEYK
YSPKLVAQKIAGLSTQGTASVASSFIRHLEGATVARISDITSTSVTLNVCRDVPTYIPNA
RLIPYACAGVGWGFIGMSGETATHLMYRVKGGARYALTPRVHLIAGAFLQGVFGSVKHQD
IDTDVVAGNISKAASH
Download sequence
Identical sequences D6Q009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]