SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6WW84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6WW84
Domain Number 1 Region: 3-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-97
Family Capz beta-1 subunit 0.0000000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6WW84
Sequence length 275
Comment (tr|D6WW84|D6WW84_TRICA) F-actin-capping protein subunit beta-like Protein {ECO:0000313|EMBL:EFA09305.2} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC030614 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MGEQQFDCALDLMRRLPPQEIEKNLGDLIDLVPHLCEDLLSSVDQPLKISRDKETGRDYL
LCDYNRDGDSYRSPWSNTYYPPLDDGSMPSERLRKLEIDANDAFDQYREMYFEGGVSSVY
FWDLEHGFAGVILIKKTGDGSKKIKGCWDSIHVVEVQEKSSGRTSHYKMTSTAMLWLQTN
KPGSGTMNLGGSLTRQIEQDAPVNEANPHIANIGRMVEDMENKIRNTLSEIYFSKTKDIV
NSLRSVQPLSESMQQQALKQDLAAALQRRQNKSDN
Download sequence
Identical sequences D6WW84
7070.XP_971537 XP_971537.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]