SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6YAP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D6YAP6
Domain Number - Region: 187-228
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00127
Family E6 C-terminal domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6YAP6
Sequence length 258
Comment (tr|D6YAP6|D6YAP6_THEBD) Uncharacterized protein {ECO:0000313|EMBL:ADG88263.1} KW=Complete proteome; Reference proteome OX=469371 OS=JCM 10125 / NBRC 14880 / R51). GN=Tbis_1548 OC=Thermobispora.
Sequence
MSACPAGVGWHAERVDAVRIKVDDELRLFLPGGDRDGERTVRVDGTSSLGHVIESLGIPL
PEVGHLEVDGREVRPDYRPRPGDLVHVRAVQRPQPVPVDPPRFLLDVHLGTLARRLRLLG
VDTAYGNDLDDDTLIVLANDQRRVLLTRDRGLLRRRSLWLGAYVRGSDPDDQLEDVLTRF
APPLAPWTRCVACNDRLVPVEKHDIAPQLQPGTRRTYDTFARCAACGRAYWRGAHYDHLQ
EIVARAERLLTPDGRADR
Download sequence
Identical sequences D6YAP6
gi|296269524|ref|YP_003652156.1| WP_013131796.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]