SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6YS46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6YS46
Domain Number 1 Region: 203-399
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.3e-68
Family B3/B4 domain of PheRS, PheT 0.00000972
Further Details:      
 
Domain Number 2 Region: 470-694
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-46
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00016
Further Details:      
 
Domain Number 3 Region: 37-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.34e-35
Family Myf domain 0.0033
Further Details:      
 
Domain Number 4 Region: 703-793
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.18e-22
Family Anticodon-binding domain of PheRS 0.0016
Further Details:      
 
Domain Number 5 Region: 405-478
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.56e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6YS46
Sequence length 797
Comment (tr|D6YS46|D6YS46_WADCW) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=716544 OS=Waddlia chondrophila (strain ATCC VR-1470 / WSU 86-1044). GN=wcw_1542 OC=Bacteria; Chlamydiae; Parachlamydiales; Waddliaceae; Waddlia.
Sequence
MKLPLSWILEVIDLNLPSHKIANMLTMAGLEVDGCTPLPLAFENVVVGEVLRTERHPDAE
KLCIATVFDGEEQFQVVCGAPNCRPGLKTAFAKIGSVLRDEEGKAFKIKKTKLRGVESYG
MLCSEDELGIGDHGSGIMEFADRIQVGADISEIYGDTVLEISLTPNLGHCASVLGVVREL
AAMTGKQYRLPAIKIEENEEEAFEAVSVEVACFEKCPRYACRVIKGVKVGPSPDWLQKKL
LACDQRPVNNVVDATNYVLMEMGHPLHAFDYDLLEERRIVVRTAQEGEAFVSLDEKRRVL
TSDDLLICDGKKPVAIAGVMGGLNSEVHEGTVNILLESAYFEAAGIRRTSKRLALQTEAS
RRFEREADPNQVLAALDRAAVLIKEISGGEICRGVVDVKQKDFSPKEVKCRLSRVNAVLG
TQLGMSEVNDLFTRLEFGVKWDGKDTFTLTIPTYRADINSEVDLIEEVARIYGFDNIPKP
SSYFTSSDMPHAPIFVFEREIRRRLMAEGLQELLTCDLIGPKLQEAVNGPIMPPENIVKV
LNPVSVEQSILRTSLLPGLLQVAKHNYDHECRNLSGFEIGRIHFKEEGRFKEQSMAGVLL
MGNRHPDHWERKKDGADFFDLKGIVESLLLETGVLDYQFRSGNLHFFHPGRQGSLCIGEQ
EVGILGEIHPTILRRMDLSNKVYYAEIDLHLLYQMRQSRRLMEPMPVYPASDRDLTVTVE
ENVAIQEILEVISSVKSRLLENVSLIDIYRGEKVGESKKNVTLRFIYRNVKKTVSQEAVD
AEHARITSQIEARIRRY
Download sequence
Identical sequences D6YS46
gi|297621760|ref|YP_003709897.1| WP_013182599.1.19835 WP_013182599.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]