SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7D9M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7D9M8
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000157
Family Preprotein translocase SecE subunit 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7D9M8
Sequence length 62
Comment (tr|D7D9M8|D7D9M8_STAHD) Protein transport protein Sec61 gamma subunit homolog {ECO:0000256|HAMAP-Rule:MF_00422} KW=Complete proteome OX=591019 OS=BK20S6-10-b1 / P8). GN=Shell_1385 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MGFRELIDSWRRIIRLATKPNKTEYMTSLKISLLGLTLVGSIAFIVRFIFISFIFPQQLY
GG
Download sequence
Identical sequences D7D9M8
WP_013143672.1.49614 gi|297527349|ref|YP_003669373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]