SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7E6I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7E6I9
Domain Number - Region: 57-102
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.012
Family Ferredoxin domains from multidomain proteins 0.072
Further Details:      
 
Domain Number - Region: 3-42
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.0314
Family E6 C-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7E6I9
Sequence length 117
Comment (tr|D7E6I9|D7E6I9_METEZ) F420H2 dehydrogenase, subunit FpoO {ECO:0000313|EMBL:ADI73211.1} KW=Complete proteome; Reference proteome OX=644295 OS=107634 / OCM 161 / Z-7303). GN=Metev_0283 OC=Methanosarcinaceae; Methanohalobium.
Sequence
MADCELCGESLPTLCPVRVYAPRLIITYPEGVCKGLCPTCVKAAEDTYSKLDQSILSVSS
GKCNLCGKPTRLYPVEVQIPSFKQGVEKVDMNLCRTCLEACHETHEKYHEKFEEAYH
Download sequence
Identical sequences D7E6I9
WP_013193779.1.99978 gi|298674257|ref|YP_003726007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]