SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7FYI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7FYI6
Domain Number 1 Region: 8-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-61
Family Capz beta-1 subunit 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7FYI6
Sequence length 308
Comment (tr|D7FYI6|D7FYI6_ECTSI) Uncharacterized protein {ECO:0000313|EMBL:CBJ32528.1} KW=Complete proteome; Reference proteome OX=2880 OS=Ectocarpus siliculosus (Brown alga) (Conferva siliculosa). GN=Esi_0345_0014 OC=Ectocarpaceae; Ectocarpus.
Sequence
MAESTEVISSCLNLMRRLPPKDIENSLEGLLNLVPQVTDELLQRVDQPLQEATDPETGRR
YLRCEYNRDASSYRSPWSNKYDPPIEDGFTPGDRLRQMEEDANMLLDAYREVYFSGGVSS
VYLWEEEADGEADNATGAAGSFAGCFLILKRVGGDGEEGPVGAWESSHVVQVVLSKKNPT
QATYKVNTTVMLSVGPEDEAVGATSLSGNLAREKEETKTFSTDSDHLQNLGVMIEAMENT
LRSDMDGLYVQKTRQIVSSVRSTRGASAARLQSPFAAQLQGAVGQHGARRQGGDLMSALN
AKLGVPPS
Download sequence
Identical sequences D7FYI6
Esi0345_0014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]