SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7KYY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7KYY1
Domain Number 1 Region: 2-246
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-71
Family Capz beta-1 subunit 0.00000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7KYY1
Sequence length 257
Comment (tr|D7KYY1|D7KYY1_ARALL) F-actin capping protein beta subunit family protein {ECO:0000313|EMBL:EFH63646.1} KW=Complete proteome; Reference proteome OX=81972 OS=Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). GN=ARALYDRAFT_476300 OC=Arabidopsis.
Sequence
MEAALGLLRRMPPKQSETALSALLSLIPQHSSDLLSQVDLPLQVLRDIESGKDFILCEYN
RDADSYRSPWSNKYLPPLEDALYPSSELRNLEVEANDIFAIYRDQYYEGGISSVYMWEDD
NEGFVACFLIKKEDGSKSGHGRRGCLEEGAWDAIHVIQVGPEEEEMAQYCLTSTIMLSLT
TDDESSGKFGLSGSIRRQMKMELAVADGHLCNMGRMIEELEGKLRNSLDQVYFGKTREMV
CTLRPPAEIVQMRLPDT
Download sequence
Identical sequences D7KYY1
59689.fgenesh2_kg.2__1430__AT1G71790.1 jgi|Araly1|476300|fgenesh2_kg.2__1430__AT1G71790.1 XP_002887387.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]