SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7PD84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7PD84
Domain Number - Region: 47-118
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7PD84
Sequence length 138
Comment (tr|D7PD84|D7PD84_SCHMA) MEG 1 isoform 6 {ECO:0000313|EMBL:ADH02231.1} OX=6183 OS=Schistosoma mansoni (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MANRDLILTPYQVFILPCFILIFWSLFLIVFKSDGSGTWRKDIDWLILTKGGKLTDFIKC
IFREINIDKDHLCTYPTNFSHGLITYCTKSNDERDLLSYEEDHIALYVIQPTNHCQRYEG
SSSLVSQKPEKECPFCFD
Download sequence
Identical sequences D7PD84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]