SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7PD85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7PD85
Domain Number - Region: 50-123
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00915
Family Capz alpha-1 subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7PD85
Sequence length 143
Comment (tr|D7PD85|D7PD85_SCHMA) MEG 1 isoform 7 {ECO:0000313|EMBL:ADH02232.1} OX=6183 OS=Schistosoma mansoni (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MANRDLILTPYQVFILPCFILIFWSLFLIVFKSDGSGTWRKDIDWLIPTKGGKLTDFIKC
IFREINIDKDYLCTYPTNFSHGLITYCTKSNRRQRLDERDLLSCEEDHIALYVIQPTNHC
QRYEGSSSLVSQKPEKECPFCFD
Download sequence
Identical sequences D7PD85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]